PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002151-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family bHLH
Protein Properties Length: 435aa    MW: 48367.8 Da    PI: 6.4592
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002151-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.42.6e-1362113154
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                         ++ +hn+ Er RR+++N  ++ Lr+llP+a   + kKls  +++ + ++YI +L
  WALNUT_00002151-RA  62 QKLNHNASERARRKKMNGLYSSLRSLLPEA--DQMKKLSIPTTVSRMIKYIPEL 113
                         5789*************************6..49999**************988 PP

2HLH41.81.9e-13267318154
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                         ++ +hn+ Er RR+++N  ++ Lr+llP+a   + kKls  +++ + ++YI +L
  WALNUT_00002151-RA 267 QKLNHNASERDRRKKMNGLYSSLRSLLPEA--DQMKKLSIPTTVSRMIKYIPEL 318
                         5789*************************6..49999**************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.37361113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000838.85E-1162117No hitNo description
PfamPF000101.4E-1062113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.36E-1362131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.6E-1263131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.2E-767119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088814.418266318IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.0E-10267318IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.7E-13267336IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.43E-11267322No hitNo description
Gene3DG3DSA:4.10.280.101.2E-12268336IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.0E-8272324IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MLAIGLESEQ YSINQDQYCQ SYEDPQTFES AHHKQVGLDP HAHVTAPTAP VGGGGGDPKM  60
VQKLNHNASE RARRKKMNGL YSSLRSLLPE ADQMKKLSIP TTVSRMIKYI PELEQQVVGL  120
IQRKEELLSR ISRQVDQNTH QENQPKGSVA AWISLSTVSA SRVNDREVVI QIPTCEDQKT  180
PLSEILLALE EDGLLLLNAS SFEVFGGRAF YNLHLQEYCQ SYGIHEDPQT FESAHHKQVG  240
LDPHAHVTAP TAPVGGGGGG GDPKMVQKLN HNASERDRRK KMNGLYSSLR SLLPEADQMK  300
KLSIPTTVSR MIKYIPELEQ QVVGLIQRKE ELLSRISRQV DQNTHQENQP KGSVAAWISL  360
STVSASRVND REVVIQIPTC EDQKTPLSEI LLALEEDGLL LLNASSFEVF GGRAFYNLHL  420
QEVIKIDKVD ACTTI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271872.13e-67PREDICTED: transcription factor ORG2
SwissprotQ9M1K16e-52ORG2_ARATH; Transcription factor ORG2
TrEMBLA5C2W41e-67A5C2W4_VITVI; Putative uncharacterized protein
TrEMBLD7TF079e-68D7TF07_VITVI; Putative uncharacterized protein
STRINGVIT_13s0047g00450.t013e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-44bHLH family protein